Loading...

Follow Foldit | Solve Puzzles for Science on Feedspot

Continue with Google
Continue with Facebook
or

Valid
This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Sequence: VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH;
Read Full Article
  • Show original
  • .
  • Share
  • .
  • Favorite
  • .
  • Email
  • .
  • Add Tags 
This symmetric design puzzle has C3 symmetry, with three symmetric chains. No more than 50% of residues may form helices, and all loops must match one of the Ideal Loop Building Blocks found in the Blueprint tool. There is no "Core Exists: Complex" objective, but we still expect that designs with a strong hydrophobic interface (orange sidechains) will score best. See the puzzle comments for Objective details. The Baker Lab will run folding predictions on your solutions for this puzzle, and those that perform well will be synthesized in the lab. Remember, you can use the Upload for Scientists button for up to 5 designs that you want us to look at, even if they are not the best-scoring solutions!;
Read Full Article
  • Show original
  • .
  • Share
  • .
  • Favorite
  • .
  • Email
  • .
  • Add Tags 
We are giving you a helix positioned over a hydrophobic groove where binding occurs in nature. You can mutate any residue on the helix but none on the native binding region. Try to look for favorable hydrophobic interactions in this groove while maintaining the helix. For players with fewer than 150 global points. START HERE: If you are new to Foldit, here are detailed instructions to get you started: http://fold.it/portal/node/988864 _____________________________ If you want to fold proteins, know that there are many ways to play and this variety is the main value of Foldit : - try all puzzles not only "Beginners" ones, - fold first the ones you like the most, - try it by yourself to understand what works and what doesn't, - ask for tips in global chat when you think you don't understand something. Make sure you have followed these tutorials: - Lonely Sheets, - Lock and Lower, - Rebuild, - Structure and Rebuild, - Movin' Along, - Control over Clashing, - Intro to Design, - Swappin' Sidechains, - Mass Mutate, - Insertion and Deletion before starting this puzzle.;
Read Full Article
  • Show original
  • .
  • Share
  • .
  • Favorite
  • .
  • Email
  • .
  • Add Tags 
This is a throwback puzzle to the early days of Foldit. This kinase protein is part of a human signaling pathway that controls cell growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Sequence: VTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVD;
Read Full Article
  • Show original
  • .
  • Share
  • .
  • Favorite
  • .
  • Email
  • .
  • Add Tags 
This symmetric design puzzle has C2 symmetry, with two symmetric chains. No more than 50% of residues may form helices, and all loops must match one of the Ideal Loop Building Blocks found in the Blueprint tool. We've omitted the "Core Exists: Complex" objective to simplify the puzzle, but we still expect that designs with a strong hydrophobic interface (orange sidechains) will score best. See the puzzle comments for Objective details. The Baker Lab will run folding predictions on your solutions for this puzzle, and those that perform well will be synthesized in the lab. Remember, you can use the Upload for Scientists button for up to 5 designs that you want us to look at, even if they are not the best-scoring solutions!;
Read Full Article
  • Show original
  • .
  • Share
  • .
  • Favorite
  • .
  • Email
  • .
  • Add Tags 
In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization by going to [Actions]>[Electron Density]. For players with fewer than 150 global points. START HERE: If you are new to Foldit, here are detailed instructions to get you started: http://fold.it/portal/node/988864 _____________________________ If you want to fold proteins, know that there are many ways to play and this variety is the main value of Foldit : - try all puzzles not only "Beginners" ones, - fold first the ones you like the most, - try it by yourself to understand what works and what doesn't, - ask for tips in global chat when you think you don't understand something. Make sure you have followed these tutorials: - Lonely Sheets, - Lock and Lower, - Rebuild, - Structure and Rebuild, - Control over Clashing, and especially: - Electron Density before starting this puzzle.;
Read Full Article
  • Show original
  • .
  • Share
  • .
  • Favorite
  • .
  • Email
  • .
  • Add Tags 
Help design a protein for cancer treatment! Integrins are cell adhesion proteins that are normally inactive on the surface of cells. Once activated by a binding partner, integrins can induce changes in cell cycle, growth factor signaling pathways, cytoskeletal organization, and movement. In some types of cancer, integrins are involved in promoting tumor metastasis and cancer blood vessel formation. We'd like to design an integrin antagonist, which can block regular binding partners and keep integrin in the inactive state! Integrin is a very large protein, and this puzzle includes only the binding portion of integrin. The integrin backbone is completely frozen, but some sidechains on the surface are allowed to move. Foldit players start with 6 loop residues already placed in the binding pocket; these residues are frozen in place and cannot move, but players have complete freedom to fold and design 65 residues flanking the frozen loop. In this puzzle, we'd like Foldit players to focus on designing a compact protein with a significant core, so we've added a Core Existence objective with a large bonus value. We think successful antagonists will also need to make at least one other major contact with the integrin surface. Because of some small differences with the previous [Round 3 puzzle](https://fold.it/portal/node/2007766), players will not be able to load in previous work. See the puzzle comments for objective details. LetÂ’s give cancer a good fight!;
Read Full Article
  • Show original
  • .
  • Share
  • .
  • Favorite
  • .
  • Email
  • .
  • Add Tags 
This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Sequence: KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA;
Read Full Article
  • Show original
  • .
  • Share
  • .
  • Favorite
  • .
  • Email
  • .
  • Add Tags 
This symmetric design puzzle has C3 symmetry, with three symmetric chains. There is no H-bond Network Objective in this puzzle, so the interface can be completely nonpolar (orange sidechains). No more than 50% of residues may form helices, and all loops must match one of the Ideal Loop Building Blocks found in the Blueprint tool. See the puzzle comments for Objective details. The Baker Lab will run folding predictions on your solutions for this puzzle, and those that perform well will be synthesized in the lab. Remember, you can use the Upload for Scientists button for up to 5 designs that you want us to look at, even if they are not the best-scoring solutions!;
Read Full Article
  • Show original
  • .
  • Share
  • .
  • Favorite
  • .
  • Email
  • .
  • Add Tags 
We are giving you this Parabacteroides Distasonis protein as an extended chain. The native is shown as a guide on this puzzle, so try using everything you have learned in the Intro levels to match the native fold. Hints and details are posted in the puzzle comments. For players with fewer than 150 global points. START HERE: If you are new to Foldit, here are detailed instructions to get you started: http://fold.it/portal/node/988864 HINT: If you are having trouble with this puzzle, try using the "Align Guide" tool: By right clicking on a region of the protein (not the guide) it will pull up a menu with 6 tools. The bottom right one is "Align Guide". Clicking on it will align the native guide to the region of the protein you selected. This will help you see what sections on your protein correspond to the guide! Working with the guide is much more user friendly when you use the advanced viewing options. In the game click on Menu->General Options and select "Show Advanced GUI" and click Done. Click on View, turn on 'Show Outline,' set the background color to white, and view stubs on the sidechains, view the guide, and set color relative to guide. Turn all the other view options off." _____________________________ If you want to fold proteins, know that there are many way to play and this variety is the main value of Foldit : - try all puzzles not only "beginners" one, - fold first the ones you like the most, - try by yourself to understand what works and what doesn't, - make your own strategy and at least try more than one, here some other strategies to play QTTN http://foldit.wikia.com/wiki/101_-_Puzzle_Levels_and_Types, - ask for tips in global when you think you doesn't understand something. Make sure you have followed these tutorials: - lonely sheets, - lock and lower, - rebuild, - structure and rebuild, - control over clashing, and especially: - Quest to the Native before starting this puzzle.;
Read Full Article

Read for later

Articles marked as Favorite are saved for later viewing.
close
  • Show original
  • .
  • Share
  • .
  • Favorite
  • .
  • Email
  • .
  • Add Tags 

Separate tags by commas
To access this feature, please upgrade your account.
Start your free month
Free Preview